KIT Ligand anticorps (Middle Region)

N° du produit ABIN634669

Cet anticorps Lapin Polyclonal détecte spécifiquement KIT Ligand dans WB. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour KIT Ligand anticorps (Middle Region) (ABIN634669)

Antigène: KIT Ligand (KITLG)

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIT Ligand est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KIT Ligand anticorps

Épitope: Middle Region

Specificité: KITLG antibody was raised against the middle region of KITLG

Purification: Affinity purified

Immunogène: KITLG antibody was raised using the middle region of KITLG corresponding to a region with amino acids TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KITLG Blocking Peptide, (ABIN5614363), is also available for use as a blocking control in assays to test for specificity of this KITLG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KITLG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIT Ligand

Antigène: KIT Ligand (KITLG)

Autre désignation: KITLG

Sujet: KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway